DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxh1

DIOPT Version :10

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_571577.1 Gene:foxh1 / 57930 ZFINID:ZDB-GENE-000616-15 Length:472 Species:Danio rerio


Alignment Length:235 Identity:74/235 - (31%)
Similarity:107/235 - (45%) Gaps:52/235 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 SSAAESLSSQNNDKLDVEFDDELEDQLDEDQ------------------ESEDGNPSKKQKMTAG 115
            ||:..|....:|..|      ||..:||:..                  |.:|||.|..:|... 
Zfish    35 SSSKRSCHRSSNPLL------ELGGRLDKSTGMAQDSCYRAKATNQGPWELQDGNSSGGKKKNY- 92

  Fly   116 SDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTK 180
            ....||||||.|:|.|.||:|||::|||:.|.:.:...||:||.|.:||::|:|||||...||.|
Zfish    93 QRYPKPPYSYLAMIAMVIQNSPEKKLTLSEILKEISTLFPFFKGNYKGWRDSVRHNLSSYDCFVK 157

  Fly   181 IPRSYDDP-GKGNYWILDPSAEEVFIGETTGKLRRKNPGASR-------TRLAAYRQAIFSPMMA 237
            :.:....| ||||:|.::.:...:.:      |:|:|...||       ..||.|....:|....
Zfish   158 VLKDPGKPQGKGNFWTVEVNRIPLEL------LKRQNTAVSRQDETIFAQDLAPYIFQGYSQPNK 216

  Fly   238 ASPYGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQ 277
            :.|. .|.||  .|.||          .|.:|...:..|:
Zfish   217 SKPL-PPESS--LPPVP----------TRQSPPPSEDPYR 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 COG5025 <11..>230 CDD:227358 63/186 (34%)
Forkhead 120..205 CDD:459732 40/85 (47%)
foxh1NP_571577.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..56 6/25 (24%)
FH_FOXH 97..175 CDD:410796 40/77 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..246 11/46 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..360
SMAD-interaction domain (SID) 339..465
Fast/FoxH1 motif 1 (FM1) 357..361
Fast/FoxH1 motif 2 (FM2) 367..373
SMAD interaction motif (SIM) 428..448
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.