DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxe3

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001073150.2 Gene:foxe3 / 570855 ZFINID:ZDB-GENE-061214-6 Length:422 Species:Danio rerio


Alignment Length:304 Identity:98/304 - (32%)
Similarity:137/304 - (45%) Gaps:78/304 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NFSIDAILAKKPINTATQPIKTEPVHHHHQYVHPYSNSDGELSASEDFDSPSRTSTPMSSAAESL 75
            |.|:|:            |:...|:..:||    ....||.|..:|          |..      
Zfish    35 NVSLDS------------PVPLPPLALNHQ----ARTKDGILIKAE----------PQG------ 67

  Fly    76 SSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQR 140
            ||.|.|:.:|....:.|:.|     ...|:..:|:.:..|    ||||||.|||.|||.:|||::
Zfish    68 SSPNTDREEVVSLGQTEEHL-----PATGSRRRKRPVQRG----KPPYSYIALIAMAIANSPERK 123

  Fly   141 LTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFI 205
            |||.|||::::.|||:::.|.:.|||||||||:||.||.||||....|||||||.|||:||::| 
Zfish   124 LTLGGIYKFIMERFPFYRENSKKWQNSIRHNLTLNDCFVKIPREPGRPGKGNYWTLDPAAEDMF- 187

  Fly   206 GETTGKLRRKNPGASRTRLAAYRQAIFSPMMAASPYGAPASSYGYPAVPFAAAAAAALYQRMNPA 270
              ..|...|:.....||.::.|.             |...||..:...|..              
Zfish   188 --DNGSFLRRRKRFKRTDVSTYP-------------GYMQSSSAFTPTPMG-------------- 223

  Fly   271 AYQAAYQQMQYQQAPQAHHHQ---APHPAQMQGYPQQLNAELFQ 311
              :.||....|......:..|   :||||.:..|  |.:|.:.|
Zfish   224 --RQAYPNTLYPGVTSGYGSQLAGSPHPAMLHHY--QASAGVTQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 54/84 (64%)
foxe3NP_001073150.2 FH 103..191 CDD:214627 55/90 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.