DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxf1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001073655.1 Gene:foxf1 / 566407 ZFINID:ZDB-GENE-050419-153 Length:380 Species:Danio rerio


Alignment Length:153 Identity:68/153 - (44%)
Similarity:100/153 - (65%) Gaps:6/153 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 QESEDGNPSKKQKMTAG-SDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKR 162
            :.|...:.:|.:|..|| ...:||||||.|||:||||.||.:||||:.|||:|.:|||:|:.:.:
Zfish    30 ETSSSSSSTKAKKTNAGIRRPEKPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQ 94

  Fly   163 GWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAY 227
            ||:||:|||||||:||.|:|:....||||:||.:||::|.:|   ..|..||: |...|.:..|.
Zfish    95 GWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMF---EEGSFRRR-PRGFRRKCQAL 155

  Fly   228 RQAIFSPMMAASPYGAPASSYGY 250
            :.:::| ||....:.....||.:
Zfish   156 KPSMYS-MMNGLGFNHIPESYNF 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 51/84 (61%)
foxf1NP_001073655.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 5/18 (28%)
FH 52..140 CDD:214627 52/90 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.