DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxq2

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001098411.1 Gene:foxq2 / 565796 ZFINID:ZDB-GENE-050208-663 Length:244 Species:Danio rerio


Alignment Length:292 Identity:86/292 - (29%)
Similarity:132/292 - (45%) Gaps:82/292 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FSIDAILAKKPINTATQPIKTEPVHHHHQYVHPYSNSDGELSASEDFDSPSRTSTPMSSAAESLS 76
            |:||.:|..|..:..    :.||              :..::.|||..     ||......::||
Zfish    17 FTIDYLLYNKGRSAG----RAEP--------------EDNVNPSEDLQ-----STVNEPEQKTLS 58

  Fly    77 SQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRL 141
            .|:::|.:       |.:.|||.|    |...|.:   |:| :||..||.|||.|||.||.|::|
Zfish    59 EQDSEKSE-------EQENDEDHE----NTHVKSE---GTD-EKPAQSYIALISMAILDSDEKKL 108

  Fly   142 TLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIG 206
            .|..|||::::.:||||:..:.|:||:|||||||:||.|..||  |.|||::|.:.|:..:.|  
Zfish   109 LLCDIYQWIMDHYPYFKSKDKNWRNSVRHNLSLNECFIKAGRS--DNGKGHFWAIHPANFQDF-- 169

  Fly   207 ETTGKLRRKNPGASRTRLAAYRQAIFSPMMAASPYGAPA--SSYG-------------YPAVPFA 256
             :.|...|:.   :|.|:..        :....||..||  .:.|             :|.:.|.
Zfish   170 -SNGDYHRRR---ARRRIRR--------VTGQLPYALPAHYQTLGRLKRTPCWCCPPSHPLLCFP 222

  Fly   257 AAAAAALYQRMNPAAYQAAYQQMQYQQAPQAH 288
                        |..|. ::..:|.|:.|..|
Zfish   223 ------------PRVYW-SWAALQTQRTPALH 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 43/84 (51%)
foxq2NP_001098411.1 Forkhead 87..171 CDD:278670 44/88 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.