DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxj2

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_686801.4 Gene:foxj2 / 558490 ZFINID:ZDB-GENE-100922-240 Length:516 Species:Danio rerio


Alignment Length:217 Identity:72/217 - (33%)
Similarity:99/217 - (45%) Gaps:48/217 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LEDQLDEDQESEDGNPS---------------KKQK-----------MTAGSDTK-KPPYSYNAL 128
            :..:||....|.|..|.               ||::           ::.||::| |||:||..|
Zfish     1 MTSELDSSLTSIDWLPQLGISTLRSGKERVERKKERGREKDIPLIPALSPGSNSKVKPPHSYATL 65

  Fly   129 IMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNY 193
            |.|||..:||.:|:||.||.::.:.|||:....|||:|||||||||||||.|:||...|||||:|
Zfish    66 IAMAISSAPEMKLSLNDIYTWISDTFPYYCRAGRGWKNSIRHNLSLNKCFRKVPRPQSDPGKGSY 130

  Fly   194 WILDPSAEEVFIGETTGKLRRKNPGAS---------RTRLAAYRQAIFSPMMAASPYGAPASSYG 249
            |.:|...      |:|.....|.|...         .|:|.|.:.....|.........|.....
Zfish   131 WTMDVPP------ESTQPRGVKRPYTDDEHVVTPFPETQLPANQPEPLPPQPDTKSTFPPPPCKQ 189

  Fly   250 YPAVPFAAAAAAALYQRMNPAA 271
            .||:|..::..:      ||.|
Zfish   190 RPAIPVPSSLPS------NPHA 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 47/84 (56%)
foxj2XP_686801.4 Forkhead 57..134 CDD:278670 46/76 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.