DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and zgc:113424

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001038244.1 Gene:zgc:113424 / 554876 ZFINID:ZDB-GENE-050227-9 Length:300 Species:Danio rerio


Alignment Length:97 Identity:35/97 - (36%)
Similarity:52/97 - (53%) Gaps:12/97 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSI 168
            |.|.:.::..||        :|..||..||::||:::||...|.:.|   .|:....||.::|:|
Zfish    56 GAPRRMKQCAAG--------TYTGLIAYAIRESPDKKLTFKQIMKKL---EPFVFGEKRNFENNI 109

  Fly   169 RHNLSLNKCFTKIPRSYDDPG-KGNYWILDPS 199
            |..||..|||.|:|...|.|. |.|:|.:|.|
Zfish   110 RVCLSAKKCFVKVPVDPDYPNPKKNFWKVDES 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 31/81 (38%)
zgc:113424NP_001038244.1 FH 69..142 CDD:294049 31/76 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.