DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxn2b

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001017555.2 Gene:foxn2b / 550127 ZFINID:ZDB-GENE-050417-1 Length:396 Species:Danio rerio


Alignment Length:316 Identity:92/316 - (29%)
Similarity:130/316 - (41%) Gaps:74/316 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GELSASEDFDSPSRTSTPMSSAAESLSSQNNDKLDVEFDDEL-------EDQLDE---------- 97
            |.|..:|...||..||......:.|:.:..::      ||||       |:.|..          
Zfish    33 GTLPEAESASSPMATSLDQIGRSVSVVAGESE------DDELTNLNWLHENLLQNFSLGGPEAQP 91

  Fly    98 ------DQESEDGNP-----SKKQKMTAGSD----TKKPPYSYNALIMMAIQDSPEQRLTLNGIY 147
                  |.|...|:|     |....::.||:    ..|||:|::.||.|||:.||.:.|.:..||
Zfish    92 INSPLFDIEGGIGSPHSNTNSSASSVSTGSERDPYKSKPPFSFSLLIYMAIEQSPSKSLPVKDIY 156

  Fly   148 QYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDP-GKGNYWILDPSAEEVFIGETTGK 211
            .:::..||||.:...||:||:||||||||||.|:.||.... |||:.|.:.|....:.: :...|
Zfish   157 GWILKHFPYFSSAPTGWKNSVRHNLSLNKCFRKVERSIGKTNGKGSLWCVHPEFRPMLM-QALKK 220

  Fly   212 LRRKNPGASRTRLAAYRQAIFSPMMAAS-PYGAPASSYG--YPAVPFAAAAAAALYQRMNPAAYQ 273
            ....|..|..|..|       ||..|:| |:....|..|  .....|.||.|..|   :..|:.|
Zfish   221 QHFPNAHAFCTPPA-------SPPSASSPPHHLFTSEQGCALKECDFDAATAMML---LKSASEQ 275

  Fly   274 AAYQQMQYQQAP----------------QAHHHQA----PHPAQMQGYPQQLNAEL 309
            ......:.|:.|                |.|::.:    |.|.||. ..|.||..|
Zfish   276 NIDSYPEEQEGPIDLSRRDLVVVSRDPKQDHNYSSTPAPPCPRQMP-LSQPLNFSL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 40/85 (47%)
foxn2bNP_001017555.2 Forkhead 129..216 CDD:278670 40/87 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.