DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxh1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001017084.1 Gene:foxh1 / 549838 XenbaseID:XB-GENE-1194372 Length:515 Species:Xenopus tropicalis


Alignment Length:180 Identity:59/180 - (32%)
Similarity:85/180 - (47%) Gaps:31/180 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QPIKTEPVHHHHQYVHPYSNSDGELSASEDFDSPSRTS----TPMSSAAESLSSQNNDKLDVEFD 88
            :.:...|.|.:.|...|:.    .|.......||.|.|    :|.:.......::..        
 Frog    34 EQVPAAPGHSYEQCAQPWP----PLYREGGTWSPDRGSMHGLSPGTQEGSCTQAEGT-------- 86

  Fly    89 DELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINR 153
               :|.|..|:     ..|:|.|........||||||.|:|.:.||:|||:||.|:.|.:.:...
 Frog    87 ---KDSLGGDE-----TLSRKSKKKNYHRYAKPPYSYLAMIALVIQNSPEKRLKLSQILKEVSTL 143

  Fly   154 FPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPG----KGNYWILDPS 199
            ||:||.:..||::|||||||.|.||.|:.:   |||    |||:|.:|.|
 Frog   144 FPFFKGDYMGWKDSIRHNLSSNDCFKKVLK---DPGKPQAKGNFWTVDVS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 43/84 (51%)
foxh1NP_001017084.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..103 11/63 (17%)
FH 110..188 CDD:238016 41/80 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 307..399
SMAD-interaction domain (SID) 377..503
Fast/FoxH1 motif 1 (FM1). /evidence=ECO:0000255 402..406
Fast/FoxH1 motif 2 (FM2). /evidence=ECO:0000255 412..418
SMAD-interaction motif (SIM) 467..488
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.