DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxi3

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001102819.1 Gene:Foxi3 / 502846 RGDID:1561816 Length:400 Species:Rattus norvegicus


Alignment Length:168 Identity:72/168 - (42%)
Similarity:93/168 - (55%) Gaps:41/168 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ASEDFDSPSRT--STPMSSAAES----LSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKM 112
            |...|..||..  ::|..|||..    ||..:.:.|                          .||
  Rat    91 AQRGFTQPSAAAPASPAGSAAPGELGWLSMASREDL--------------------------MKM 129

  Fly   113 TAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKC 177
            .      :|||||:|||.||||.:||::|||:.|||::.:.||:::.:|.|||||||||||||.|
  Rat   130 V------RPPYSYSALIAMAIQSAPERKLTLSHIYQFVADNFPFYQRSKAGWQNSIRHNLSLNDC 188

  Fly   178 FTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRK 215
            |.|:||..|||||||||.|||:.|::|   ..|..|||
  Rat   189 FKKVPRDEDDPGKGNYWTLDPNCEKMF---DNGNFRRK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 54/84 (64%)
Foxi3NP_001102819.1 Forkhead 131..217 CDD:278670 55/88 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.