DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxd3

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001011383.1 Gene:foxd3 / 496851 XenbaseID:XB-GENE-487289 Length:369 Species:Xenopus tropicalis


Alignment Length:278 Identity:96/278 - (34%)
Similarity:130/278 - (46%) Gaps:91/278 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 SSAAESLSSQ---NNDKLDVEFDDELEDQLDEDQESEDGNP------------------------ 106
            ||:|..:|.|   :.|..|::...|.::.||:|  ||.|:|                        
 Frog     6 SSSASDMSGQTVLSADDADIDVVGEGDEPLDKD--SECGSPAGHAEEADELGGKEIARSPSGSAN 68

  Fly   107 -------SKKQKMTAGSDTK------KPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFK 158
                   |::|:   |...|      ||||||.|||.|||..||:::|||:||.:::.|||||::
 Frog    69 EAEGKGESQQQE---GMQNKPKNSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYR 130

  Fly   159 ANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIG----ETTGKLRRKNPGA 219
            .....||||||||||||.||.||||...:|||||||.|||.:|::|..    ....:.:|:.|.:
 Frog   131 EKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKRFKRQQPDS 195

  Fly   220 SRTRLAAYRQAIFSPMMAASPYGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQA 284
            .|.:.|...|: |.....|.|||.|   ||                 ::||||            
 Frog   196 LREQTALMMQS-FGAYSLAGPYGRP---YG-----------------LHPAAY------------ 227

  Fly   285 PQAHHHQAPHPAQMQGYP 302
                    .|||.:| ||
 Frog   228 --------THPAALQ-YP 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 53/84 (63%)
foxd3NP_001011383.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 19/87 (22%)
Forkhead 92..177 CDD:365978 53/84 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.