DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxj1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_012827170.1 Gene:foxj1 / 496834 XenbaseID:XB-GENE-853648 Length:512 Species:Xenopus tropicalis


Alignment Length:304 Identity:85/304 - (27%)
Similarity:129/304 - (42%) Gaps:49/304 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SEMEFKSNFSI-DAILAKKPINTATQPIKTEPVHHHHQYVHPYSNSDGELSASED-FDSPSRTST 66
            :.:::...||| :|.:.|.|.:..:           |.|.|........|:|... ...|.....
 Frog   115 TSLQWLQEFSILNANVGKAPSSGDS-----------HGYKHLSGAPCSPLAADPACLGMPHTPGK 168

  Fly    67 PMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMM 131
            |:||:....|...           |:...|.|.::   ||.           .||||||..||.|
 Frog   169 PISSSTSRASHLG-----------LQPMEDIDYKT---NPH-----------VKPPYSYATLICM 208

  Fly   132 AIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWIL 196
            |:|.|.:.::||:.||:::.:.|.||:.....|||||||||||||||.|:||..|:||||.:|.:
 Frog   209 AMQASKKTKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWKI 273

  Fly   197 DPS-AEEVFIGETTGKLRRKNPGASRTRLAAYRQAIFSPMMAASPYGAPASSYGYPAV-PFAAAA 259
            ||. |:.:..|..  |.||..|.......|:.:.|........||:....:|..:..: .|..|.
 Frog   274 DPQYADRLMNGAM--KKRRLPPVQIHPAFASAQAAASGNSNRGSPWQLSVNSESHQLLKEFEEAT 336

  Fly   260 AAALYQRMNPAAYQAAYQQMQYQQAPQAHHHQAPHPAQMQGYPQ 303
            ....:..:....:.|.       ...::|..:.|.|.:|...|:
 Frog   337 GEQGWNALGEHGWNAI-------SDGKSHKRKQPLPKRMFKAPR 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 46/85 (54%)
foxj1XP_012827170.1 Forkhead 197..283 CDD:278670 46/85 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.