DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxd1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001008148.1 Gene:foxd1 / 493510 XenbaseID:XB-GENE-488077 Length:329 Species:Xenopus tropicalis


Alignment Length:262 Identity:98/262 - (37%)
Similarity:130/262 - (49%) Gaps:39/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SLSSQNNDKL----DVEFDDELEDQLDEDQESED--GN--PSKKQ--------KMTAG----SDT 118
            :|||..:|.|    |::...|.::...|::|.||  |:  |:..|        |.|.|    |..
 Frog     2 TLSSDMSDVLAEETDIDVVGEDDEPRAEEEEDEDLHGDLLPTSPQSSATKDPYKGTGGGGGRSAL 66

  Fly   119 KKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPR 183
            .||||||.|||.|||..||::||||:.|.:::.|||||::.....||||||||||||.||.||||
 Frog    67 VKPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPR 131

  Fly   184 SYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAYRQAIFSPMMAASPYGAPASSY 248
            ...:|||||||.|||.:.::|...:..:.|::........|.......|.|..|.| ||..:.:|
 Frog   132 EPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQQAPELVLREPGHFLPASAYS-YGPYSCAY 195

  Fly   249 GYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQAPQAHHHQAP--HPAQMQG-------YPQQ 304
            |....||...:|...:|:.         ||...||.|......||  .|...|.       ||.|
 Frog   196 GIQLQPFHPHSALIAFQQQ---------QQQARQQPPSLPPMAAPALMPPAAQDLSRTCTFYPHQ 251

  Fly   305 LN 306
            |:
 Frog   252 LS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 52/84 (62%)
foxd1NP_001008148.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 17/60 (28%)
Forkhead 68..153 CDD:365978 52/84 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.