DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxj1.2

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001008143.1 Gene:foxj1.2 / 493505 XenbaseID:XB-GENE-919738 Length:371 Species:Xenopus tropicalis


Alignment Length:181 Identity:65/181 - (35%)
Similarity:99/181 - (54%) Gaps:18/181 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 NPSKKQKMTAGSDTK-KPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSI 168
            :||..|::...::.. ||||||..||.||::.|.:::|||:.||.::...|.|::.....|||||
 Frog    93 SPSPVQEVDYRTNANIKPPYSYATLICMAMEASQQRKLTLSAIYSWITQNFCYYRHADPSWQNSI 157

  Fly   169 RHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAYRQAI-- 231
            ||||||||||.|:||..|:||||.:|.:||...::|:   .|.|:|:...||........:||  
 Frog   158 RHNLSLNKCFMKVPRGKDEPGKGGFWQMDPRYADMFV---NGVLKRRRMPASHLDPPRCNKAIAH 219

  Fly   232 --FSPMMAASPYGAPASSYGYPAVPFAAAAAAALYQRMNPA--AYQAAYQQ 278
              :.|:...|.:.....|.|:        ..:..|::.||.  |.:|..:|
 Frog   220 HPYLPVSRPSSHHMQHISGGH--------RQSRRYEKPNPVLPALRAPERQ 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 44/84 (52%)
foxj1.2NP_001008143.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..74
COG5025 <61..>262 CDD:227358 64/179 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..99 2/5 (40%)
Forkhead 108..194 CDD:365978 44/85 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..248 4/27 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.