DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxc1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001007864.1 Gene:foxc1 / 493250 XenbaseID:XB-GENE-479055 Length:495 Species:Xenopus tropicalis


Alignment Length:258 Identity:83/258 - (32%)
Similarity:115/258 - (44%) Gaps:93/258 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 DTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKI 181
            |..||||||.|||.||||::||:::|||||||:::.|||:::.||:|||||||||||||:||.|:
 Frog    76 DMVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMERFPFYRDNKQGWQNSIRHNLSLNECFVKV 140

  Fly   182 PRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRK---------------------------NPGA 219
            ||....||||:||.|||.:..:|  |....|||:                           .|.|
 Frog   141 PRDDKKPGKGSYWTLDPDSYNMF--ENGSFLRRRRRFKKKDVVKDATKEDKDRLLKEHHGSQPAA 203

  Fly   220 S---RTRLAAYRQA-------------------------IFSPMMAA-----SPYGAPASSYGYP 251
            :   |.:.....||                         ..||.::.     ||..:.:.|.|.|
 Frog   204 AQQQRQQQQGQAQAEQDSGSQPVRIQDIKTENGTSSPPQAMSPALSTVPKIESPDSSSSMSSGSP 268

  Fly   252 -AVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQAPQAHHHQAPHPAQ----------MQGYPQ 303
             ::|                    :.:.|..:.|...|.||..|.:|          ::|.||
 Frog   269 HSIP--------------------SNRSMSLEAAESHHPHQQHHHSQGFSVDNIMTSLRGSPQ 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 54/84 (64%)
foxc1NP_001007864.1 Forkhead 79..164 CDD:365978 55/86 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..322 23/157 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.