DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxj2

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_031760837.1 Gene:foxj2 / 448174 XenbaseID:XB-GENE-483646 Length:522 Species:Xenopus tropicalis


Alignment Length:210 Identity:68/210 - (32%)
Similarity:101/210 - (48%) Gaps:49/210 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GNPS------KKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKR 162
            |:|:      .|::..|..| .||||||..||..||..:|.:|:||:.||:::.:.|||::....
 Frog    48 GSPTDPSAMLSKEEAAAHRD-GKPPYSYANLIQYAINSAPAKRMTLSEIYRWICDNFPYYRNAGV 111

  Fly   163 GWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAY 227
            ||:|||||||||||||.|:||..||||||:||::|...:     |.....|||.|.         
 Frog   112 GWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWMIDSCPK-----EDVALPRRKRPH--------- 162

  Fly   228 RQAIFSPMMAASPYGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQAPQAH--HH 290
                                      |....:..:..|.:|.:..::|.:....|:..|.|  ::
 Frog   163 --------------------------PDDEVSQDSFEQDVNKSPLRSASEVSMPQEGTQGHPMNN 201

  Fly   291 QAPHPAQMQGYPQQL 305
            .:|.|:..|..|.|:
 Frog   202 NSPLPSYSQANPTQM 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 46/84 (55%)
foxj2XP_031760837.1 FH_FOXJ2 68..149 CDD:410825 46/80 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.