DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and fd96Cb

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster


Alignment Length:269 Identity:76/269 - (28%)
Similarity:116/269 - (43%) Gaps:89/269 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLN 175
            ||:.|.  :||||||.:|..|||..||::.|.|:.||::::::||:::.|.:.||||:|||||.|
  Fly     6 KMSYGD--QKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFN 68

  Fly   176 KCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKN------------------------ 216
            .||.|:||:....|||:||.|.|.|.::|  |....|||:.                        
  Fly    69 DCFIKVPRNVTKAGKGSYWTLHPMAFDMF--ENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEM 131

  Fly   217 ------------------------PGASRTRLAAYR-----------------------QAIFSP 234
                                    ..||..:::.|:                       :::.:|
  Fly   132 VTHYLDDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLPARPKRAFTIESLMAP 196

  Fly   235 MMAASP--------YGAP-ASSYGYPA--VPFAAAAAAALYQRMNPA-AYQAAYQQMQ-YQQAPQ 286
            ..|::|        ||:| |.:...|.  :||.....||.||...|: .|...|..:. ||:.|.
  Fly   197 DPASTPNEGLVPMEYGSPDAVALEKPPFNLPFNFNELAAQYQLYFPSFFYNGQYGNIPCYQKTPP 261

  Fly   287 AHHHQAPHP 295
            ..|: .|.|
  Fly   262 LFHN-GPLP 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 42/84 (50%)
fd96CbNP_524496.1 FH 13..101 CDD:214627 44/89 (49%)
Alpha_kinase 106..>194 CDD:295997 3/87 (3%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445505
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.