DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxo

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001262557.1 Gene:foxo / 41709 FlyBaseID:FBgn0038197 Length:622 Species:Drosophila melanogaster


Alignment Length:333 Identity:85/333 - (25%)
Similarity:131/333 - (39%) Gaps:133/333 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VEFDDELE------DQL---DEDQESEDGNPSKKQKMTAGSDTKKPPY---SYNALIMMAIQDSP 137
            ||..|||:      .||   |..|..::.|.:||      :.:::..:   ||..||..||..:.
  Fly    54 VEPTDELDSTKASNQQLAPGDSQQAIQNANAAKK------NSSRRNAWGNLSYADLITHAIGSAT 112

  Fly   138 EQRLTLNGIYQYLINRFPYFK-----ANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILD 197
            ::||||:.||::::...||||     .:..||:|||||||||:..|.::..  :..||.::|:|:
  Fly   113 DKRLTLSQIYEWMVQNVPYFKDKGDSNSSAGWKNSIRHNLSLHNRFMRVQN--EGTGKSSWWMLN 175

  Fly   198 PSAEEVFIGETTGK-LRR-----------KNPGASRTRLAAYRQAIFSPMMAASPYGAPASSYG- 249
            |.|:       .|| :||           |..|.::.|:.|.|||....:..|:|  :|:||.. 
  Fly   176 PEAK-------PGKSVRRRAASMETSRYEKRRGRAKKRVEALRQAGVVGLNDATP--SPSSSVSE 231

  Fly   250 ----YPAVPF--------------AAAAAAALYQRMNP--------------------------- 269
                :|..|.              .|::.|:...|::|                           
  Fly   232 GLDHFPESPLHSGGGFQLSPDFRQRASSNASSCGRLSPIRAQDLEPDWGFPVDYQNTTMTQAHAQ 296

  Fly   270 --------------------AAYQAA-----------YQQMQYQQAPQAHHHQAPH----PAQMQ 299
                                ..:.||           ||..|:|||.|....|:|:    ||  .
  Fly   297 ALEELTGTMADELTLCNQQQQGFSAASGLPSQPPPPPYQPPQHQQAQQQQQQQSPYALNGPA--S 359

  Fly   300 GY----PQ 303
            ||    ||
  Fly   360 GYNTLQPQ 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 34/92 (37%)
foxoNP_001262557.1 FH 95..175 CDD:238016 31/81 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445509
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.