DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and jumu

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster


Alignment Length:243 Identity:76/243 - (31%)
Similarity:110/243 - (45%) Gaps:48/243 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KKPINTATQP--IKTEPVHHHHQYVHPYS-NSDGELSASEDFDSPSRTSTPMSSAAESLSSQNND 81
            |:.:..:|.|  |.:.....|||....|| .|...||:|.       .|:|:.:.:..::..||:
  Fly   327 KRGLQASTTPKSIASAANSPHHQMQSNYSLGSPSSLSSSS-------ASSPLGNVSNLVNIANNN 384

  Fly    82 KLDVEFDDELEDQLDEDQESEDGNPSKK---QKM---TAGSDTKKPPYSYNALIMMAIQDSPEQR 140
                              .|..|:...|   ||:   ..||...||.|||:.||.:|:::|....
  Fly   385 ------------------TSGAGSGLVKPLQQKVKLPPVGSPFPKPAYSYSCLIALALKNSRAGS 431

  Fly   141 LTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKI--PRSYDDPGKGNYWILDPSA--- 200
            |.::.||.:|...||||:....||:||:||||||||||.||  |.:..:..||..|.::|..   
  Fly   432 LPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINK 496

  Fly   201 --EEVFIGETTGKLRRKNPGASRTRLAAYRQAIFSPMMAASPYGAPAS 246
              |||      .|..||:|.|.|..: .|.|.:.|.......:|:..|
  Fly   497 MDEEV------QKWSRKDPAAIRGAM-VYPQHLESLERGEMKHGSADS 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 41/91 (45%)
jumuNP_524302.1 Forkhead 411..499 CDD:278670 38/87 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445503
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.