DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxf2a

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001077284.1 Gene:foxf2a / 407681 ZFINID:ZDB-GENE-110407-5 Length:383 Species:Danio rerio


Alignment Length:284 Identity:93/284 - (32%)
Similarity:129/284 - (45%) Gaps:61/284 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SASEDFD-SPSRTSTPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMTAG- 115
            ||.:..| .|...|:|.|::..| :.||...:               .||.....:|.:|..:| 
Zfish     5 SAQQQLDPPPPLRSSPASNSMHS-ALQNTQTV---------------LESTTATGNKGKKSNSGM 53

  Fly   116 SDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTK 180
            ...:||||||.|.|:||||.||.:||||:.|||:|..|||:|:.:.:||:||:|||||||:||.|
Zfish    54 RRPEKPPYSYIAPIVMAIQSSPTKRLTLSEIYQFLQARFPFFRGSYQGWKNSVRHNLSLNECFIK 118

  Fly   181 IPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLA---AYRQAIFSPMMAASPYG 242
            :|:....||||:||.:||.:|.:|   ..|..||:..|..|...|   .||      ||....:|
Zfish   119 LPKGLGRPGKGHYWTIDPGSEFMF---EEGSFRRRPRGFRRKCQALKPMYR------MMNGIGFG 174

  Fly   243 AP------------------ASSYGYPAVPFAAAAAAALY---------QRMNP---AAYQAAYQ 277
            |.                  |:||....:..|.....|.|         ..|:|   :.|..|.|
Zfish   175 ASMLPQNFDFQSPSASLACHANSYNLDMMSNAVQGVHAGYDGLGAGHHVSHMSPSTGSTYMTACQ 239

  Fly   278 -QMQYQQAPQAHHHQAPHPAQMQG 300
             ....:..|.:.:.....|..|.|
Zfish   240 VASNGEYGPDSSNSPLHSPPTMSG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 50/84 (60%)
foxf2aNP_001077284.1 FH 58..146 CDD:214627 51/90 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.