DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxg1b

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_998079.2 Gene:foxg1b / 405850 ZFINID:ZDB-GENE-040426-2437 Length:341 Species:Danio rerio


Alignment Length:241 Identity:98/241 - (40%)
Similarity:135/241 - (56%) Gaps:34/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 PSRTSTPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSY 125
            ||:..:...||....|......||...:|...|....|.|..:....|.:|.      .|||:||
Zfish    24 PSKFDSADESAERGGSPAPVQDLDKPPEDAEMDNAQRDAEEPELQTKKGKKF------DKPPFSY 82

  Fly   126 NALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGK 190
            ||||||||:.|||:||||||||::::..|||::.:|:||||||||||||||||.|:||.||||||
Zfish    83 NALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYREHKQGWQNSIRHNLSLNKCFVKVPRHYDDPGK 147

  Fly   191 GNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAYRQAIFSPMMAASPYGAPASSYGYPAVPF 255
            ||||:||||:::||||.|||||||:: ..||.:|...|...|:|:                .:..
Zfish   148 GNYWMLDPSSDDVFIGGTTGKLRRRS-ATSRGKLVMKRGLRFAPL----------------GLGL 195

  Fly   256 AAAAAAALYQRMNPAAYQAAYQQMQYQQAPQAHHHQAPHPAQMQGY 301
            ....:..||.:::|           :.....:|::.:.|....||:
Zfish   196 GERPSNPLYWQLSP-----------FLPLHHSHYNGSAHGFLNQGH 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 62/84 (74%)
foxg1bNP_998079.2 FH 77..165 CDD:214627 65/87 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1751
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.