DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and croc

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster


Alignment Length:334 Identity:93/334 - (27%)
Similarity:133/334 - (39%) Gaps:112/334 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 HHHQYVHPYSNSDGELSASE---------DFDSPSRTSTPMSSAAESLSSQNNDKLDVEFDDELE 92
            |:.|....|.::....:||.         .:|..||  .|.|::|..|.:.:.:|          
  Fly    14 HYAQTAAGYGSASAVAAASSASAAAAAHYAYDQYSR--YPYSASAYGLGAPHQNK---------- 66

  Fly    93 DQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYF 157
                                    :..||||||.|||.||||::.::::||||||||::.||||:
  Fly    67 ------------------------EIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYY 107

  Fly   158 KANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRR--KNPGAS 220
            :.||:|||||||||||||:||.|:.|....||||:||.|||.:..:|...:..:.||  |.....
  Fly   108 RDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVM 172

  Fly   221 RTRLAAY-RQAIFSPMMA--------------ASPYGAPASSY---------------------- 248
            |.:..|. |||:.:..:|              |....|.|:.:                      
  Fly   173 REKEEAIKRQAMMNEKLAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAML 237

  Fly   249 ----------------GYPAVPFAAAAAAALYQRMNPAAYQAAY---------QQMQYQQAPQAH 288
                            |.....|...:...:|   ||..:.:||         ..:...|....|
  Fly   238 NSCHDSLAQMNHLAGGGVEHPGFTVDSLMNVY---NPRIHHSAYPYHLNEDNLATVASSQMHHVH 299

  Fly   289 HHQAPHPAQ 297
            |..|.|.||
  Fly   300 HAAAAHHAQ 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 53/84 (63%)
crocNP_524202.1 Forkhead 70..156 CDD:278670 54/85 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445506
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.