DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxa2

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_989423.1 Gene:foxa2 / 395063 XenbaseID:XB-GENE-480476 Length:434 Species:Xenopus tropicalis


Alignment Length:272 Identity:90/272 - (33%)
Similarity:129/272 - (47%) Gaps:55/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SPSRTSTPMSSAAESLSS----QNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMTAGSDT-K 119
            |||  .:|||:.|.|:::    .|.:.:...:.            ..:.|.|:..|....|.| .
 Frog    98 SPS--MSPMSAQATSMNALAPYTNMNSMSPIYG------------QSNINRSRDPKTYRRSYTHA 148

  Fly   120 KPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRS 184
            ||||||.:||.||||.||.:.|||:.|||::::.||:::.|::.|||||||:||.|.||.|:|||
 Frog   149 KPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRS 213

  Fly   185 YDDPGKGNYWILDPSAEEVFIGETTGKLRR-------KNP------------GASRTRLAAYRQA 230
            .|.||||::|.|.|.:..:|  |....|||       |.|            |:|....||...:
 Frog   214 PDKPGKGSFWTLHPDSGNMF--ENGCYLRRQKRFKCEKKPSLREGGGKKLSEGSSSVGSAANSSS 276

  Fly   231 IF-----SPMMAASPYGAP-------ASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQ 283
            ..     ||..::||....       .||.|..  |..||:.|:..|.:....:.....:.|...
 Frog   277 ESSVGNESPHSSSSPCQEQKRSLVDMKSSQGLS--PDHAASPASQAQHLLSQHHSVLSHEAQSHL 339

  Fly   284 APQAHHHQAPHP 295
            .|: ||:...||
 Frog   340 KPE-HHYSFNHP 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 47/84 (56%)
foxa2NP_989423.1 Forkhead_N 17..148 CDD:369872 14/63 (22%)
FH 149..237 CDD:214627 49/89 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..339 19/91 (21%)
HNF_C 349..423 CDD:370449 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.