DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxa4

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_988938.1 Gene:foxa4 / 394535 XenbaseID:XB-GENE-486455 Length:399 Species:Xenopus tropicalis


Alignment Length:230 Identity:77/230 - (33%)
Similarity:110/230 - (47%) Gaps:46/230 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRS 184
            ||||||.:||.||||.:|.:.:|||.|||::|:.|||::.|::.|||||||:||.|.||.|:|||
 Frog   119 KPPYSYISLITMAIQQAPNKMMTLNEIYQWIIDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVPRS 183

  Fly   185 YDDPGKGNYWILDPSAEEVFIGETTGKLRR-KNPGASRTRLAAYRQAIFSP------MMAASPYG 242
            .:.||||:||.|.|.:..:|  |....||| |.....|::.....:.:..|      .:..:|.|
 Frog   184 PEKPGKGSYWTLHPESGNMF--ENGCYLRRQKRFKCERSKSGEREKKVNKPGDENGGSLKETPVG 246

  Fly   243 -APASSYGYPAVPF----AAAAAAALYQR-------MNPAAYQA-AYQQMQYQ-----------Q 283
             ...||...|..|.    ..:..::::|.       ::|.:.|| ...|:.|.           .
 Frog   247 YDDCSSSRSPQAPVNDGGRDSTGSSIHQASGGSPVGLSPTSEQAGTASQLMYPLGLSNDGYLGLV 311

  Fly   284 APQAHHHQAP----HP---------AQMQGYPQQL 305
            ....|....|    ||         .|.|.||.:|
 Frog   312 GEDVHLKHDPFSGRHPFSITQLMSSEQDQTYPSKL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 48/84 (57%)
foxa4NP_988938.1 Forkhead_N <25..118 CDD:369872
COG5025 <118..303 CDD:227358 68/185 (37%)
FH 119..207 CDD:214627 50/89 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..290 10/70 (14%)
HNF_C 326..387 CDD:370449 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.