Sequence 1: | NP_476730.1 | Gene: | slp1 / 33607 | FlyBaseID: | FBgn0003430 | Length: | 322 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_988938.1 | Gene: | foxa4 / 394535 | XenbaseID: | XB-GENE-486455 | Length: | 399 | Species: | Xenopus tropicalis |
Alignment Length: | 230 | Identity: | 77/230 - (33%) |
---|---|---|---|
Similarity: | 110/230 - (47%) | Gaps: | 46/230 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 120 KPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRS 184
Fly 185 YDDPGKGNYWILDPSAEEVFIGETTGKLRR-KNPGASRTRLAAYRQAIFSP------MMAASPYG 242
Fly 243 -APASSYGYPAVPF----AAAAAAALYQR-------MNPAAYQA-AYQQMQYQ-----------Q 283
Fly 284 APQAHHHQAP----HP---------AQMQGYPQQL 305 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
slp1 | NP_476730.1 | FH | 120..205 | CDD:214627 | 48/84 (57%) |
foxa4 | NP_988938.1 | Forkhead_N | <25..118 | CDD:369872 | |
COG5025 | <118..303 | CDD:227358 | 68/185 (37%) | ||
FH | 119..207 | CDD:214627 | 50/89 (56%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 219..290 | 10/70 (14%) | |||
HNF_C | 326..387 | CDD:370449 | 7/21 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |