DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxm1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_957391.1 Gene:foxm1 / 394072 ZFINID:ZDB-GENE-040426-1275 Length:623 Species:Danio rerio


Alignment Length:258 Identity:68/258 - (26%)
Similarity:97/258 - (37%) Gaps:79/258 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GELSASEDFDSPSRT----STPMSSAAESLSSQNNDKLDVEFDDEL----------EDQLDEDQE 100
            |:.|..|     |:|    ||.:.|   .|.....:......||.|          .|.|..::.
Zfish   100 GDTSLEE-----SKTLGCFSTELGS---ELGKVKKESECFPLDDSLTNIQWLGKMSSDGLGSEKC 156

  Fly   101 SEDGNPSKKQKMTAGSD------TKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFK- 158
            ....||:..|:.:.|.:      :::|||||.|:|..||.....:.:||..||.::.:.||||: 
Zfish   157 PNKDNPNDSQQQSKGPEKENDPHSERPPYSYMAMIQFAINSKNNRHMTLKEIYNWIEDHFPYFRD 221

  Fly   159 ANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTR 223
            ..|.||:|||||||||:..|.   |.....||.:||.:.|.|                     .|
Zfish   222 IAKPGWKNSIRHNLSLHDMFI---RETSPDGKISYWTIRPEA---------------------NR 262

  Fly   224 LAAYRQAIFSPMMAASPYGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQAPQ 286
            .....| ::.|:             |.|..|..            |...|.|..|.|.:.||:
Zfish   263 CLTLDQ-VYKPL-------------GDPLTPTC------------PQIPQVAIHQQQKRGAPE 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 37/85 (44%)
foxm1NP_957391.1 FH 182..256 CDD:238016 35/76 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.