DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and FoxK

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster


Alignment Length:312 Identity:89/312 - (28%)
Similarity:134/312 - (42%) Gaps:53/312 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QPIKTEPVHH----------HHQYVHPYSNSDGELSAS--------------------------- 55
            |..:.:|.||          ||..:|......|.:..:                           
  Fly   328 QQQQQQPAHHPLPHTPHHPLHHTALHQQQQRSGSIVVAPPAGAAAHLIAGDGPGIYSPLKISIPK 392

  Fly    56 EDFDSPSRTSTPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMTAG-SDTK 119
            ::..||..:.|...|||.|..:...........:...:..:.:.:.....||     ||. :..:
  Fly   393 KEQKSPYLSPTGTISAANSCPASPRQGFIQNQPNNYNNYGNNNTQDLFQTPS-----TASYNHNE 452

  Fly   120 KPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYF-KANKRGWQNSIRHNLSLNKCFTKIPR 183
            ||||||..||:.||..:|:::|||:|||.:::..:||: |...:|||||||||||||:.|.|:.|
  Fly   453 KPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVAR 517

  Fly   184 SYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAYRQAIFSPM-MAASPYGAP--- 244
            |.|:||||::|.:||.:....|..:..|.|:::....|......|.|..||. |..|...:|   
  Fly   518 SQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQGFRPPYGMPRSAPVSPSHMDNSRESSPLQD 582

  Fly   245 ---ASSYGYPAVPFAAAAA--AALYQRMNPAAYQAAYQQMQYQQAPQAHHHQ 291
               .|:.|.|.:.....||  ..:|...|....|...||.|.||....:.:|
  Fly   583 IVLQSAPGSPGMSLEQRAADPEIIYNSQNAHQQQQQQQQQQQQQTLSNNSNQ 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 45/85 (53%)
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 45/86 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445507
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.