DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and bin

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster


Alignment Length:352 Identity:99/352 - (28%)
Similarity:145/352 - (41%) Gaps:88/352 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DAILAKKPINTA-TQP--IKTEPVHHHHQYVHPYSNSDGELSASEDFD----------------- 59
            |...|....:|| .||  ::.:|::|.:.....|.:::..|||: |:.                 
  Fly   152 DLQYASSSTSTAKVQPLQVQLQPLNHQYASTIKYCSNNTILSAN-DYQLLTSQEQAGQQQPQQLP 215

  Fly    60 ------SP-----SRTST------------PM----SSAAESLSSQNNDKLDVEFDDELEDQLDE 97
                  ||     ||.||            |:    ||::....|.|..:......:.||:::..
  Fly   216 AQQLQHSPGGGYMSRISTSPSQVISNAHGMPVLNYSSSSSSPAKSLNGSESSPPSQNHLENKVSG 280

  Fly    98 DQESEDGNPSKKQKMTAGSDTK--------KPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRF 154
            ......|..|::...:....||        ||..||..:|..||::||..:|||:.||.||...:
  Fly   281 SAVVGTGGSSQQDAPSTPDTTKKSGTRRPEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSY 345

  Fly   155 PYFKANKRGWQNSIRHNLSLNKCFTKIPR--SYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNP 217
            .:|:....||:||:|||||||:||.|:|:  ....|||||||.:|.::..:|  |..|.|||:..
  Fly   346 EFFRGPYVGWKNSVRHNLSLNECFKKLPKGMGVGKPGKGNYWTIDENSAHLF--EDEGSLRRRPR 408

  Fly   218 GASRTRLAAYRQAIFSPMMAASPYGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQA--AYQQMQ 280
            |        ||..|     ...||...|:  ||.|..:..|.       |:...|.|  |:....
  Fly   409 G--------YRSKI-----KVKPYAGHAN--GYYASGYGDAG-------MDNGNYYASPAFASYD 451

  Fly   281 YQQAPQAHHHQAPHPAQMQGYPQQLNA 307
            |..|...    ...||..||:....||
  Fly   452 YSAAGAT----GVSPAGGQGFADPWNA 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 40/86 (47%)
binNP_523950.2 Forkhead 311..399 CDD:278670 41/89 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445453
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.