DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxi3a

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_944599.2 Gene:foxi3a / 387257 ZFINID:ZDB-GENE-031126-3 Length:353 Species:Danio rerio


Alignment Length:238 Identity:85/238 - (35%)
Similarity:114/238 - (47%) Gaps:47/238 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRH 170
            ||::..|    ...:|||||:|||.|||..:|.:||||:.||||:.:.||::..:|..|||||||
Zfish   106 PSQEDLM----KLVRPPYSYSALIAMAIHGAPNRRLTLSQIYQYVADNFPFYNKSKASWQNSIRH 166

  Fly   171 NLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVF-IGETTGKLRRKNPGASRTRLAAYR---QAI 231
            |||||.||.|:||...||||||||.|||:.|::| .|....|.:||:...:......|.   .|:
Zfish   167 NLSLNDCFMKVPRDDSDPGKGNYWTLDPNCEKMFDNGNFRRKRKRKSDSLAEEEGKGYSGSDSAL 231

  Fly   232 FSPMMAA-------SP---------------YGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQA 274
            .||...:       ||               .|..||......:|  :..|..|.||.:|.....
Zfish   232 SSPKNPSDSSERGNSPISTDQAPCLNSFLNQMGDVASGSREALLP--SPLAVPLSQRSSPTGVYG 294

  Fly   275 AYQ----QMQYQ-QAPQAHHHQAPH----------PAQMQGYP 302
            :|.    ..|:: |.||:.....|:          |...|.||
Zfish   295 SYSPNATMPQWETQIPQSSISSTPYKDGYSDSMLNPYSSQLYP 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 53/85 (62%)
foxi3aNP_944599.2 FH 116..204 CDD:214627 53/87 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.