DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxi2

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_944598.2 Gene:foxi2 / 387256 ZFINID:ZDB-GENE-031126-2 Length:383 Species:Danio rerio


Alignment Length:164 Identity:75/164 - (45%)
Similarity:101/164 - (61%) Gaps:19/164 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRS 184
            :|||||:|||.||||::.|::|||:.||||:.:.||::|.:|.|||||||||||||.||.|:||.
Zfish   129 RPPYSYSALIAMAIQNAHEKKLTLSQIYQYVADNFPFYKKSKAGWQNSIRHNLSLNDCFKKVPRD 193

  Fly   185 YDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPG--------ASRTRLAAYRQAIFSPMMAASPY 241
            .|||||||||.|||:.|::|   ..|..|||...        :|.|:....||     :....|.
Zfish   194 EDDPGKGNYWTLDPNCEKMF---DNGNFRRKRKRRSDSSTGVSSNTKPEDDRQ-----LAGIKPT 250

  Fly   242 GAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAA 275
            .:|..:  .||.|.|.||..: ::..:||...:|
Zfish   251 DSPHLT--GPASPDADAATDS-HKGASPAGLASA 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 55/84 (65%)
foxi2NP_944598.2 Forkhead 129..215 CDD:278670 56/88 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.