DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxl3

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001182057.1 Gene:Foxl3 / 384244 MGIID:3646467 Length:216 Species:Mus musculus


Alignment Length:234 Identity:76/234 - (32%)
Similarity:117/234 - (50%) Gaps:41/234 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 FDDELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLI 151
            |:|:.:|.       ..|:..:::::|      :|.|||.|||.||||.||..|:||:|||.:::
Mouse    12 FNDDADDY-------PAGSSDEEKRLT------RPAYSYIALIAMAIQQSPAGRVTLSGIYDFIM 63

  Fly   152 NRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSY-DDPGKGNYWILDPSAEEVFIGETTGKLRRK 215
            .:|||::||:|.||||||||||||.||.|:||:. :|.||||||......|.:......|..||:
Mouse    64 RKFPYYRANQRAWQNSIRHNLSLNSCFVKVPRTEGNDKGKGNYWTFAGGCESLLDLFENGNFRRR 128

  Fly   216 NPGASRTRLAAYRQAIFSPMMAASPYGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQ 280
                 |.|....|:....| :..:..|:|...         :|.|.....:.:|..::.....:.
Mouse   129 -----RRRRGPKREEAPGP-LEPTARGSPGPD---------SAQAPDHEAQASPTTHRDIKFSID 178

  Fly   281 Y-QQAP--------QAHHHQAPHPAQMQGYPQQLNAELF 310
            | ..:|        ..|..:|.:||.   .|||::.:.:
Mouse   179 YILSSPDPFPTLRSSCHSQEARYPAL---EPQQMSFQFW 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 50/85 (59%)
Foxl3NP_001182057.1 Forkhead 32..118 CDD:278670 50/85 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.