DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxc1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_599165.1 Gene:Foxc1 / 364706 RGDID:1589718 Length:553 Species:Rattus norvegicus


Alignment Length:263 Identity:89/263 - (33%)
Similarity:119/263 - (45%) Gaps:79/263 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 DTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKI 181
            |..||||||.|||.||||::|::::|||||||::::|||:::.||:|||||||||||||:||.|:
  Rat    75 DMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKV 139

  Fly   182 PRSYDDPGKGNYWILDPSAEEVFIG-------------------ETTGKLRRKNPGASRTRLAAY 227
            ||....||||:||.|||.:..:|..                   |..|:|..:.|...:    |.
  Rat   140 PRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAVKDKEEKGRLHLQEPPPPQ----AG 200

  Fly   228 RQAIFSPMMAASPYGAPASSYG-------------------YPAVPFAAAAA-----AALYQRM- 267
            ||...:|     |..|..|:.|                   .|..|.:.|||     ||...:: 
  Rat   201 RQPAPAP-----PEQAEGSAPGPQQPPVRIQDIKTENGTCPSPPQPLSPAAALGSGSAATVPKIE 260

  Fly   268 ----------------------NPAAYQAAYQQMQYQQAPQAHHHQA----PHPAQMQGYPQQLN 306
                                  .|.:..||......|.||..||.|.    .....::|.||...
  Rat   261 SPDSSSSSLSSGSSPPGSLPSARPLSLDAAEPAPPPQPAPPPHHSQGFSVDNIMTSLRGSPQGSA 325

  Fly   307 AEL 309
            |||
  Rat   326 AEL 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 53/84 (63%)
Foxc1NP_599165.1 FH 78..166 CDD:214627 54/87 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.