DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxi1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_859424.1 Gene:foxi1 / 353313 ZFINID:ZDB-GENE-030505-1 Length:377 Species:Danio rerio


Alignment Length:288 Identity:100/288 - (34%)
Similarity:134/288 - (46%) Gaps:87/288 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KKPINTATQPIKTEPV-----------------------HHHHQY--VHPYSNSDGELSASED-- 57
            ::|.:..|.|::.:.:                       |||||.  .||.|...||.|:...  
Zfish    14 QQPSSQQTSPLQQQDILDMTVYCDSNFSMYQQNLHHHHHHHHHQRPPAHPSSYGLGEYSSPSTNP 78

  Fly    58 ---FDSPSRTSTPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGNP------------- 106
               .:||..||||.      |||.|....       ::.....:|......|             
Zfish    79 YLWMNSPGITSTPY------LSSPNGGSY-------IQSGFGSNQRQFLPPPTGFGSADLGWLSI 130

  Fly   107 SKKQ---KMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSI 168
            |.:|   ||.      :|||||:|||.||||::.:::|||:.||||:.:.||::|.:|.||||||
Zfish   131 SSQQELFKMV------RPPYSYSALIAMAIQNAQDKKLTLSQIYQYVADNFPFYKKSKAGWQNSI 189

  Fly   169 RHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLA-------- 225
            |||||||.||.|:.|..|||||||||.|||:.|::|   ..|..|||     |.|.|        
Zfish   190 RHNLSLNDCFKKVARDEDDPGKGNYWTLDPNCEKMF---DNGNFRRK-----RKRRADGNAMSVK 246

  Fly   226 ---AYRQAIFSPMMAASP---YGAPASS 247
               |.:.|..|.:|:||.   ..:|.||
Zfish   247 SEDALKLADTSSLMSASQPSLQNSPTSS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 53/84 (63%)
foxi1NP_859424.1 Forkhead 141..227 CDD:278670 54/88 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.