DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and FOXI3

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001129121.1 Gene:FOXI3 / 344167 HGNCID:35123 Length:420 Species:Homo sapiens


Alignment Length:248 Identity:81/248 - (32%)
Similarity:121/248 - (48%) Gaps:48/248 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRS 184
            :|||||:|||.||||.:||::|||:.|||::.:.||:::.:|.|||||||||||||.||.|:||.
Human   145 RPPYSYSALIAMAIQSAPERKLTLSHIYQFVADSFPFYQRSKAGWQNSIRHNLSLNDCFKKVPRD 209

  Fly   185 YDDPGKGNYWILDPSAEEVF-IGETTGKLRRKNPGASRTRLAA------------------YRQA 230
            .|||||||||.|||:.|::| .|....|.:|::..::.:.:||                  .:..
Human   210 EDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRRSEASNGSTVAAGTSKSEEGLSSGLGSGVGGKPE 274

  Fly   231 IFSPMMAASPYGAP---------ASSYGYP-------------AVPFAAAAAAALYQRMNPAAYQ 273
            ..||.....|..:|         |||.|.|             ::...:.:::...||..|.:..
Human   275 EESPSTLLRPSHSPEPPEGTKSTASSPGGPMLTSTPCLNTFFSSLSSLSVSSSVSTQRALPGSRH 339

  Fly   274 AAYQQMQYQQ----APQAHHHQAPHPAQMQGYPQQLNAELFQRMQFFGKFPSS 322
            ...|..|...    :|.:....:....|:.........   ||..::..||:|
Human   340 LGIQGAQLPSSGVFSPTSISEASADTLQLSNSTSNSTG---QRSSYYSPFPAS 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 55/85 (65%)
FOXI3NP_001129121.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..122
Forkhead 145..231 CDD:278670 55/85 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..306 13/71 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..396 6/29 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.