DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxk1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_956196.1 Gene:foxk1 / 334470 ZFINID:ZDB-GENE-030131-6402 Length:639 Species:Danio rerio


Alignment Length:323 Identity:89/323 - (27%)
Similarity:148/323 - (45%) Gaps:55/323 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KPINTATQPIK-TEPVHHHHQYVHPYSNSDGELSASEDFDSPSRTSTPMSSAAESLSSQNNDKLD 84
            :|:.....|:| |.|.:.....:.|..:..|.:|...     |..::|..:.:.......|...|
Zfish   169 RPLYPQISPLKITIPDNDFKTMMSPLPSPTGTISVPN-----SCPASPRGAGSSGYRYGRNITSD 228

  Fly    85 VEFDDELEDQLDEDQESE-DGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQ 148
            ::...|...:...:|.:| .|..|.|       |..||||||..||:.||..:.:::|||:|||.
Zfish   229 LQLAAEYAAKAVSEQRTEATGGDSPK-------DESKPPYSYAQLIVQAISSAQDRQLTLSGIYA 286

  Fly   149 YLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLR 213
            ::...:||::...:|||||||||||||:.|.|:|||.::||||::|.:|||:|...:.:...|.|
Zfish   287 HITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRVDPSSEAKLVEQAFRKRR 351

  Fly   214 RKNPGASRTRLAAYRQAIFSPMMAASPYGAPASSYGYPAVPFAAAAAA----------ALYQRMN 268
            ::.....||                 |:| |.||...||.|..:...:          .|.:..:
Zfish   352 QRGVSCFRT-----------------PFG-PLSSRSAPASPTHSGLLSPHSSGLQTPECLSREGS 398

  Fly   269 PAAYQ-------AAYQQMQYQQAPQAHHHQAPHPAQ--MQGYPQQLNAELFQRMQFFGKFPSS 322
            |.:::       |:..:.:|.|:...    :|..||  :...|.|.:|.:.:.:.:.....||
Zfish   399 PVSHEHDFGSKLASVPEYRYSQSAPG----SPVSAQPVIMAVPSQSSAAISKPVAYMPSIISS 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 45/84 (54%)
foxk1NP_956196.1 FHA 23..165 CDD:224630
FHA 68..152 CDD:238017
Forkhead 258..344 CDD:278670 45/85 (53%)
Cyto_heme_lyase 370..>465 CDD:279589 16/92 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.