DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxk2a

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001184186.1 Gene:foxk2a / 324141 ZFINID:ZDB-GENE-030131-2861 Length:544 Species:Danio rerio


Alignment Length:336 Identity:102/336 - (30%)
Similarity:146/336 - (43%) Gaps:72/336 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PINTATQPIK---TEPVHHHHQYVHPYSNSDGELSASEDFDSPSRTSTPMSSAAESLSSQNNDK- 82
            |:.....|:.   .|.:.|...   |..:..|.:||:        .|.|.|.....|||....: 
Zfish   122 PVKAQISPLTISIPENITHLRS---PLPSPTGTISAA--------NSCPSSPRGAGLSSYRMGRG 175

  Fly    83 LDVEFDDELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIY 147
            |..|..:| ..|.:.|:|:..|:..|        |..||||||..||:.||..:|:::|||||||
Zfish   176 LTAELINE-NSQSEIDKEASGGDSPK--------DDSKPPYSYAQLIVQAITMAPDKQLTLNGIY 231

  Fly   148 QYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKL 212
            .::...:||::...:|||||||||||||:.|.|:.||.::||||::|.:|||:|...:.:...|.
Zfish   232 THITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVARSQEEPGKGSFWRIDPSSEGKLMDQAFRKR 296

  Fly   213 RRKNPGASRTRLA--AYRQAIFSP----MMAASPYG--APASS---YGYPAVPFAAAAAA----- 261
            |.:.....||.|.  :.|.|..||    :::|...|  .|.||   ...|..|..:||||     
Zfish   297 RPRGVPCFRTPLGPLSSRSAPASPTHTGVLSAHSSGVQTPDSSREGSPLPLEPEPSAAAAPQPKL 361

  Fly   262 -----------------------ALYQRMNPAAYQAAYQQMQYQQAP--QAHH--HQAP-----H 294
                                   .|.|.:.|.::..|.........|  |..|  ||.|     .
Zfish   362 AVIQESCFTQNTPGSPVLIAVQQPLQQSLKPVSFSVATPASSAAPQPVMQTLHLLHQIPAACVFR 426

  Fly   295 PAQMQGYPQQL 305
            ..|..|..|::
Zfish   427 AEQQNGDAQEV 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 46/84 (55%)
foxk2aNP_001184186.1 FHA 16..105 CDD:238017
Forkhead 204..290 CDD:278670 46/85 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.