DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and FOXA3

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_004488.2 Gene:FOXA3 / 3171 HGNCID:5023 Length:350 Species:Homo sapiens


Alignment Length:171 Identity:67/171 - (39%)
Similarity:87/171 - (50%) Gaps:45/171 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRS 184
            ||||||.:||.||||.:|.:.|||:.|||::::.|||::.|::.|||||||:||.|.||.|:.||
Human   117 KPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARS 181

  Fly   185 YDDPGKGNYWILDPSAEEVFIGETTGKLRRK------------------------NPGASRTRLA 225
            .|.||||:||.|.||:..:|  |....|||:                        ...||.|..|
Human   182 PDKPGKGSYWALHPSSGNMF--ENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPA 244

  Fly   226 AYRQAIFSPMMAASP----------------YGAPASSYGY 250
            |   .:.||.....|                .|:||||..|
Human   245 A---TVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPY 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 48/84 (57%)
FOXA3NP_004488.2 FH 117..205 CDD:214627 50/89 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 217..276 9/61 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.