DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxj3

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001101441.1 Gene:Foxj3 / 313554 RGDID:1311770 Length:622 Species:Rattus norvegicus


Alignment Length:224 Identity:78/224 - (34%)
Similarity:108/224 - (48%) Gaps:58/224 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 PSRTSTPMSSAAE-SLSS-------------QNND-----------KLDVEFDDELEDQLDEDQE 100
            ||.||..|:|..| ||:|             |.:|           |.:...|.......:|.|:
  Rat     9 PSVTSLRMTSELESSLTSMDWLPQLTMRAAIQKSDATQNAHGTGISKKNALLDPNTTLDQEEVQQ 73

  Fly   101 SEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQ 165
            .:||               ||||||.:||..||..||::::||:.|||::.:.|||::....||:
  Rat    74 HKDG---------------KPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWK 123

  Fly   166 NSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAYRQA 230
            |||||||||||||.|:|||.||||||:||.:|.:.:     |.|...|.|....|..|       
  Rat   124 NSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPK-----EDTLPTRPKKRARSVER------- 176

  Fly   231 IFSPMMAASPYGAPASSYGYPAVPFAAAA 259
                  |::||...:.|.|...:...:|:
  Rat   177 ------ASTPYSIDSDSLGMECIISGSAS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 48/84 (57%)
Foxj3NP_001101441.1 COG5025 <54..345 CDD:227358 66/179 (37%)
FH_FOXJ3 77..155 CDD:410826 48/92 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.