DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxd2

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_233422.5 Gene:Foxd2 / 313504 RGDID:1304642 Length:494 Species:Rattus norvegicus


Alignment Length:371 Identity:107/371 - (28%)
Similarity:146/371 - (39%) Gaps:109/371 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 ELSASEDFDSPSRTSTPMS--------SAAESLSSQNNDKLDVEF--------DDELEDQLDEDQ 99
            |:.:||  .||:..|.|.:        |....|::::..:...:.        .:|.|..:.||:
  Rat     9 EIMSSE--SSPAALSEPDADIDVVGGGSGGGELTARSGPRAPRDVLPHGHELPPEEAEADVAEDE 71

  Fly   100 ESED-------------------GNPSKKQKMTAG--------------------SDTKKPPYSY 125
            |...                   |:|....:...|                    |...||||||
  Rat    72 EESGGCSDCEPRALGPRGAAAAAGSPGPGVQAARGATGPGPGPGPGPPSGGAATRSPLVKPPYSY 136

  Fly   126 NALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGK 190
            .|||.|||..||::||||:.|.:::..||||::.....||||||||||||.||.||||...:|||
  Rat   137 IALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGK 201

  Fly   191 GNYWILDPSAEEVFIGETTGKLRRK-------------------------------NPGASRTRL 224
            ||||.|||.:.::|  :....|||:                               :|||..:..
  Rat   202 GNYWTLDPESADMF--DNGSFLRRRKRFKRQPLPPPHPHPHPHPELLLRGGAAAAGDPGAFLSGF 264

  Fly   225 AAYRQAIFSPMMAASPYGAP---ASSYGYPAVPFAAAAAAALYQRMNPAAYQAA----------Y 276
            |||....:...:|...||||   .:.:.:|.....|.||.|..|...|....||          :
  Rat   265 AAYGAYGYGYGLALPAYGAPPPGPAPHPHPHPHAFAFAATAPCQLSVPPGRAAAPPPGPPTASVF 329

  Fly   277 QQMQYQQAPQAHHHQAPHPAQMQGYPQQLNAELFQRMQFFGKFPSS 322
            .......||.......|.||   |.|..|.|||.....|   :|:|
  Rat   330 ASATSAPAPAPAPGSGPSPA---GLPAFLGAELGCAKAF---YPAS 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 51/84 (61%)
Foxd2XP_233422.5 FH_FOXD1_D2-like 131..229 CDD:410820 55/99 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.