DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and fd3F

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001356931.1 Gene:fd3F / 31336 FlyBaseID:FBgn0264954 Length:764 Species:Drosophila melanogaster


Alignment Length:338 Identity:103/338 - (30%)
Similarity:137/338 - (40%) Gaps:91/338 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PINTATQPIKTEPVHHHHQYVHPYSNSDGELSASEDFDSPS--------RTSTPMS--------- 69
            |.:||. ||.|.|....    .|.|.|....|||....:.|        |..:|.|         
  Fly   279 PPSTAV-PIATSPCSSS----SPSSASAASASASAISTNQSLGSGLVDQRARSPKSCSSAAMPAA 338

  Fly    70 -----------SAAESLSSQNNDKLDVEFDD---ELEDQLDEDQESEDGNPSKKQKMTAGSDT-- 118
                       |||..::...:.|...:|::   |:..:|       |||.....:.....||  
  Fly   339 LGGGGNGSAGASAAGGVAGVGSTKTGRKFEELVMEVTSEL-------DGNDMIVAEHVVVEDTSS 396

  Fly   119 ---KKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCF-- 178
               ||||::|..||..|::|..|  ||::||||::.:||||:|:|...|:||:|||||:|..|  
  Fly   397 KAPKKPPFTYTELIEYALEDKGE--LTVSGIYQWISDRFPYYKSNDDRWKNSVRHNLSINPHFRK 459

  Fly   179 -TKIPRSYDDPGKGNYWILD--PSAEEVFIGETTGKLRR-----KNPGASRTRLAAYRQ------ 229
             .|.|:     |.|:.|.:.  .|||.|...|  .|.:|     |....:|.|:..::|      
  Fly   460 GVKAPQ-----GAGHLWAISSGDSAENVLAWE--HKKQRLDLFFKMESINRERIQQHQQQQQLQQ 517

  Fly   230 -----AIFSPMM----AASPYGAP-ASSYGYPAVPFAAAAAAALYQRM---NPAAYQAAYQQMQY 281
                 ...||..    ||.....| |||..|..   ||.|.|.|.|.|   |.........|.|.
  Fly   518 HQQQHQQHSPQQKQHSAAQQQHMPQASSCMYDE---AAVAVATLTQEMMQTNSGGGSTETSQQQQ 579

  Fly   282 QQAPQAHHHQAPH 294
            ||  |.|||...|
  Fly   580 QQ--QQHHHHHSH 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 40/89 (45%)
fd3FNP_001356931.1 Forkhead 401..473 CDD:333958 36/78 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.