DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxs1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001012091.1 Gene:Foxs1 / 311547 RGDID:1310679 Length:327 Species:Rattus norvegicus


Alignment Length:245 Identity:85/245 - (34%)
Similarity:118/245 - (48%) Gaps:44/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRH 170
            |...:.:...::..||||||.|||.||||.||.||.||:|||:|::.||.:::.|:.||||||||
  Rat     4 PPTAESLAPSTEPSKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRH 68

  Fly   171 NLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVF-IGETTGKLRR--KNPGASRTRLAAYRQAIF 232
            |||||:||.|:||....||||:||.|||...::| .|....:.||  |..||..|:...  :|..
  Rat    69 NLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFQHGSFLRRRRRFTKRTGAQGTKGPV--KADH 131

  Fly   233 SPMMAASP-YGAPASSYGY-----PAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQAPQAHHHQ 291
            .|:.|.|| .|||.::.|.     |.||             ||..:......:.....|.....:
  Rat   132 RPLRATSPDQGAPNTTTGRLCPFPPEVP-------------NPKGFGGLMGSLPANMCPTTSDTR 183

  Fly   292 APHP-------AQMQGYPQQLN-------------AELFQRMQFFGKFPS 321
            ...|       :...|.|::|:             :..|...:..||.|:
  Rat   184 PQLPTGPKDMCSAKSGGPRELSEATSPSPCPAFGFSSAFSEAESLGKAPT 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 54/85 (64%)
Foxs1NP_001012091.1 Forkhead 18..103 CDD:278670 53/84 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.