DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxe3

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_056573.1 Gene:Foxe3 / 30923 MGIID:1353569 Length:288 Species:Mus musculus


Alignment Length:217 Identity:83/217 - (38%)
Similarity:106/217 - (48%) Gaps:40/217 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PSKKQK--MTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSI 168
            |.|:::  :..|    ||||||.|||.||:..:|.:||||..||:::..||.:::.:.|.|||||
Mouse    52 PGKRRRRPLQRG----KPPYSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYRDSPRKWQNSI 112

  Fly   169 RHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAA------- 226
            ||||:||.||.|:||...:|||||||.|||:|.::|   ..|...|:.....|..|.|       
Mouse   113 RHNLTLNDCFVKVPREPGNPGKGNYWTLDPAAADMF---DNGSFLRRRKRFKRAELPAPPPPPPP 174

  Fly   227 YRQAIFSPMMAASPYGAPA-------SSYGY---------PAVPFAAAAAAALYQRMNPAAYQAA 275
            :..|.|.|..|  |..||.       |..|.         |..|..||..||    ..|.|  ||
Mouse   175 FPYAPFPPPPA--PASAPPARLFRLDSLLGLQPEPPGPVAPEPPCCAAPDAA----FPPCA--AA 231

  Fly   276 YQQMQYQQAPQAHHHQAPHPAQ 297
            .....|..|.:.....||.|||
Mouse   232 ASPPLYSPASERLGLPAPLPAQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 48/84 (57%)
Foxe3NP_056573.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 2/9 (22%)
FH 64..152 CDD:214627 49/90 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..189 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.