Sequence 1: | NP_476730.1 | Gene: | slp1 / 33607 | FlyBaseID: | FBgn0003430 | Length: | 322 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571374.1 | Gene: | foxa3 / 30559 | ZFINID: | ZDB-GENE-980526-423 | Length: | 441 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 72/202 - (35%) |
---|---|---|---|
Similarity: | 101/202 - (50%) | Gaps: | 31/202 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 VHPYSNSDGELSASE---DFDSPSRTSTPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESED 103
Fly 104 GNPSKKQKM------------TAGSDTK-------------KPPYSYNALIMMAIQDSPEQRLTL 143
Fly 144 NGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGET 208
Fly 209 TGKLRRK 215 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
slp1 | NP_476730.1 | FH | 120..205 | CDD:214627 | 48/84 (57%) |
foxa3 | NP_571374.1 | Forkhead_N | 17..142 | CDD:254796 | 19/104 (18%) |
FH | 143..231 | CDD:214627 | 50/89 (56%) | ||
HNF_C | 374..>408 | CDD:286443 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |