DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxa3

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_571374.1 Gene:foxa3 / 30559 ZFINID:ZDB-GENE-980526-423 Length:441 Species:Danio rerio


Alignment Length:202 Identity:72/202 - (35%)
Similarity:101/202 - (50%) Gaps:31/202 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VHPYSNSDGELSASE---DFDSPSRTSTPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESED 103
            ::.|.|.:...|.|.   .:.|....|:|:||.....:..:...:....:.....||. ...|..
Zfish    38 LNSYINLNSACSTSSMNMGYPSAGLNSSPLSSMGGGPNHMSLSPVGSSLNPSSLTQLG-SSASTL 101

  Fly   104 GNPSKKQKM------------TAGSDTK-------------KPPYSYNALIMMAIQDSPEQRLTL 143
            |..|..|.|            |:.:.||             ||||||.:||.||||.|..:.|||
Zfish   102 GPLSHYQSMGQPMSQISYPSPTSLNRTKEMPKPYRRSLTHAKPPYSYISLITMAIQQSQSKMLTL 166

  Fly   144 NGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGET 208
            |.|||::::.|||::.|::.|||||||:||.|.||.|:.||.|.||||:||.|.|::..:|  |.
Zfish   167 NEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPNSGNMF--EN 229

  Fly   209 TGKLRRK 215
            ...|||:
Zfish   230 GCYLRRQ 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 48/84 (57%)
foxa3NP_571374.1 Forkhead_N 17..142 CDD:254796 19/104 (18%)
FH 143..231 CDD:214627 50/89 (56%)
HNF_C 374..>408 CDD:286443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.