DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxd3

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_571365.2 Gene:foxd3 / 30548 ZFINID:ZDB-GENE-980526-143 Length:371 Species:Danio rerio


Alignment Length:260 Identity:92/260 - (35%)
Similarity:122/260 - (46%) Gaps:55/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DGELSASEDFDSPSRTSTPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMT 113
            :|:....:|.|..|:.........|.:..:.......|.:.:.|.:.|. |||..|....|.|  
Zfish    30 EGDEGMEQDSDCESQCMQDRGDEVEEIEVKERSDSPCESNADGETKGDA-QESSTGPMQNKPK-- 91

  Fly   114 AGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCF 178
              |...||||||.|||.|||..||:::|||:||.:::.|||||::.....||||||||||||.||
Zfish    92 --SSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCF 154

  Fly   179 TKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRK------NPGASRTRLAAYRQAIFSPMMA 237
            .||||...:|||||||.|||.:|::|  :....|||:      .|...|.:.|...|: |.....
Zfish   155 VKIPREPGNPGKGNYWTLDPQSEDMF--DNGSFLRRRKRFKRHQPDILRDQTALMMQS-FGAYGI 216

  Fly   238 ASPYGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQAPQAHHHQAPHPAQMQGYP 302
            .:|||   ..||                 ::||||                    .|||.:| ||
Zfish   217 GNPYG---RHYG-----------------IHPAAY--------------------THPAALQ-YP 240

  Fly   303  302
            Zfish   241  240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 53/84 (63%)
foxd3NP_571365.2 Forkhead 96..182 CDD:278670 54/87 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.