DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxd2

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_571346.2 Gene:foxd2 / 30525 ZFINID:ZDB-GENE-980605-6 Length:369 Species:Danio rerio


Alignment Length:262 Identity:92/262 - (35%)
Similarity:116/262 - (44%) Gaps:64/262 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 HHHQYVHPYSNSDGELS--ASEDFDSPSRTSTPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQ 99
            |||...|..::||..||  |.|...||.::|  :...|:.:..:         ||.....|..|:
Zfish    34 HHHLSFHLDNDSDDNLSQNAGEGAISPGQSS--LDCPADRVGQR---------DDSRTGALTGDK 87

  Fly   100 ESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGW 164
                  |.|...:       ||||||.|||.|||..||::||||:.|.:::.|||||::.....|
Zfish    88 ------PGKNALV-------KPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAW 139

  Fly   165 QNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKL--RRKNPGASRTRLAAY 227
            |||||||||||.||.||||...:|||||||.|||.:.::|   ..|..  |||.....:|.....
Zfish   140 QNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMF---DNGSFLRRRKRFKRHQTNEILR 201

  Fly   228 RQAIFSPMMAASPYGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQAPQAHHHQA 292
            ....|.|.....|||     |.|                           .:|.|.. .|||...
Zfish   202 EAGGFLPGFGYGPYG-----YNY---------------------------GLQLQNF-HAHHPYH 233

  Fly   293 PH 294
            ||
Zfish   234 PH 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 52/84 (62%)
foxd2NP_571346.2 Forkhead 95..181 CDD:278670 53/88 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.