DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxk1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001032296.2 Gene:Foxk1 / 304298 RGDID:1309643 Length:719 Species:Rattus norvegicus


Alignment Length:236 Identity:75/236 - (31%)
Similarity:117/236 - (49%) Gaps:32/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KPINTATQPIKTE-PVHHHHQYVHPYSNSDGELSASEDFDSPSRTSTPMSSAAESLSSQNNDKLD 84
            :|:.....|:|.. |.......|.|..:..|.:|...     |..::|..:.:.|.....|...|
  Rat   202 RPLYPQISPLKIHIPEPDLRSLVSPIPSPTGTISVPN-----SCPASPRGAGSSSYRFVQNVTSD 261

  Fly    85 VEFDDELEDQLDEDQESE-DGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQ 148
            ::...|...:...:|::: .|..|.|       |..||||||..||:.||..:.:::|||:|||.
  Rat   262 LQLAAEFAAKAASEQQADTSGGDSPK-------DESKPPYSYAQLIVQAISSAQDRQLTLSGIYA 319

  Fly   149 YLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLR 213
            ::...:||::...:|||||||||||||:.|.|:|||.::||||::|.:||::|...:.:...|.|
  Rat   320 HITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRR 384

  Fly   214 RKNPGASRTRLAAYRQAIFSPMMAASPYGAPASSYGYPAVP 254
            ::.....||                 |:| |.||...||.|
  Rat   385 QRGVSCFRT-----------------PFG-PLSSRSAPASP 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 44/84 (52%)
Foxk1NP_001032296.2 FHA <88..190 CDD:224630
FHA 96..189 CDD:238017
Forkhead 291..377 CDD:278670 44/85 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.