DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxk2

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_006247952.1 Gene:Foxk2 / 303753 RGDID:1305408 Length:650 Species:Rattus norvegicus


Alignment Length:329 Identity:90/329 - (27%)
Similarity:136/329 - (41%) Gaps:79/329 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KPINTATQPIKTEPVHHHHQYVHPYSNSDGELSASEDFDSPSRTSTPMSSAAESLSSQNNDKLDV 85
            ||:.....|:...........:.|..:..|.:||:....|..|.:   .|:...:.......|::
  Rat   164 KPVQPHISPLTINIPDTMAHLISPLPSPTGTISAANSCPSSPRGA---GSSGYKMGRVIPSDLNL 225

  Fly    86 EFDDELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYL 150
            ..|:   .|.:.::|:..|:..|        |..||||||..||:.||..:|:::|||||||.::
  Rat   226 MADN---SQPENEKEASGGDSPK--------DDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHI 279

  Fly   151 INRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRK 215
            ...:||::...:|||||||||||||:.|.|:|||.::||||::|.:||::|...:.:...|.|.:
  Rat   280 TKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLVEQAFRKRRPR 344

  Fly   216 ---------------------------------------------------NPGASRTRLAAYRQ 229
                                                               .||||:.:||..::
  Rat   345 GVPCFRTPLGPLSSRSAPASPNHAGVLSAHSSGAQTPESLSREGSPAPLEPEPGASQPKLAVIQE 409

  Fly   230 AIFSPMMAASPYGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQAP---QAHH-- 289
            |.|    |.|..|:|.||.     |........|...:.|..|..|.........|   |..|  
  Rat   410 ARF----AQSAPGSPLSSQ-----PVLITVQRQLPPAIKPVTYTVATPVTTPTSQPPVVQTVHVV 465

  Fly   290 HQAP 293
            ||.|
  Rat   466 HQIP 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 46/84 (55%)
Foxk2XP_006247952.1 FHA 41..145 CDD:238017
Forkhead 249..335 CDD:278670 46/85 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.