DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxd3

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_008762182.2 Gene:Foxd3 / 29203 RGDID:621715 Length:469 Species:Rattus norvegicus


Alignment Length:252 Identity:96/252 - (38%)
Similarity:120/252 - (47%) Gaps:60/252 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 EDQESEDGNPSKKQKMTAG-------SDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRF 154
            ||..:..|.|......|.|       :...||||||.|||.|||..||:::|||:||.:::.|||
  Rat   101 EDAVTGGGGPGAGGGATGGLTPNKPKNSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRF 165

  Fly   155 PYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGA 219
            ||::.....||||||||||||.||.||||...:|||||||.|||.:|::|  :....|||     
  Rat   166 PYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMF--DNGSFLRR----- 223

  Fly   220 SRTRLAAYRQ--------------AIFSPMMAAS--PYGAP--------ASSYGYPAVPFAAAAA 260
             |.|...::|              ..:|...|||  |||.|        |.:|.:||...|||||
  Rat   224 -RKRFKRHQQEHLREQTALMMQSFGAYSLAAAASAGPYGRPYGLHPAAAAGAYSHPAAAAAAAAA 287

  Fly   261 AALYQRMNPAAYQAAYQQMQYQQAPQAHHHQAPHPAQMQGYPQQLNAELFQRMQFFG 317
            |||              |..|...|.|       |......|...:.||.::...||
  Rat   288 AAL--------------QYPYALPPVA-------PVLPPAVPLLPSGELGRKAAAFG 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 53/84 (63%)
Foxd3XP_008762182.2 FH_FOXD3 130..226 CDD:410821 58/103 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.