DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxi1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001099246.1 Gene:Foxi1 / 287185 RGDID:1307421 Length:372 Species:Rattus norvegicus


Alignment Length:218 Identity:84/218 - (38%)
Similarity:112/218 - (51%) Gaps:40/218 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRH 170
            ||:::.|    ...:|||||:|||.|||..:|:|||||:.||||:.:.||::..:|.||||||||
  Rat   107 PSQEELM----KLVRPPYSYSALIAMAIHGAPDQRLTLSQIYQYVADNFPFYNKSKAGWQNSIRH 167

  Fly   171 NLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVF-IGETTGKLRRKNPGASRT----------RL 224
            |||||.||.|:||..|||||||||.|||:.|::| .|....|.:||:..:|.|          ||
  Rat   168 NLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRKSDASSSTGSLASEKTENRL 232

  Fly   225 AAYRQAIFSP---MMAASP---------YGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQ 277
            .:.......|   :..|||         ..:||.| |.|.:....:...|.....||.:..||..
  Rat   233 LSSSPKPTEPQEVLDTASPDTTSSSPEKRSSPAPS-GTPCLNNFLSTMTAYVNGTNPISRSAATP 296

  Fly   278 QMQYQQAPQAHHHQAPHPAQMQG 300
            .:            :|.|....|
  Rat   297 GL------------SPEPVDKMG 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 56/85 (66%)
Foxi1NP_001099246.1 FH 117..205 CDD:214627 56/87 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.