Sequence 1: | NP_476730.1 | Gene: | slp1 / 33607 | FlyBaseID: | FBgn0003430 | Length: | 322 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036314.2 | Gene: | FOXB1 / 27023 | HGNCID: | 3799 | Length: | 325 | Species: | Homo sapiens |
Alignment Length: | 217 | Identity: | 80/217 - (36%) |
---|---|---|---|
Similarity: | 108/217 - (49%) | Gaps: | 45/217 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 119 KKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPR 183
Fly 184 SYDDPGKGNYWILDPSAEEVFIGETTGKLRRK--------------NPG--------ASRTRLAA 226
Fly 227 Y-RQAIFSPMMAASPY--GAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQAPQAH 288
Fly 289 HHQAPHPAQM--------QGYP 302 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
slp1 | NP_476730.1 | FH | 120..205 | CDD:214627 | 48/84 (57%) |
FOXB1 | NP_036314.2 | FH_FOXB2 | 1..110 | CDD:410817 | 53/99 (54%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 284..325 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2114 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |