DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxi2

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_899016.2 Gene:Foxi2 / 270004 MGIID:3028075 Length:311 Species:Mus musculus


Alignment Length:205 Identity:85/205 - (41%)
Similarity:105/205 - (51%) Gaps:48/205 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRS 184
            :|||||:|||.||||.:|.:||||:.||||:...||::|.:|.|||||||||||||.||.|:||.
Mouse    99 RPPYSYSALIAMAIQSAPLRRLTLSQIYQYVAGNFPFYKRSKAGWQNSIRHNLSLNDCFKKVPRD 163

  Fly   185 YDDPGKGNYWILDPSAEEVFIGETTGKLRRKN-----------PGASR---TRLAAYRQAIFSPM 235
            .:||||||||.|||:.|::|   ..|..|||.           ||||.   |.|.........|.
Mouse   164 ENDPGKGNYWTLDPNCEKMF---DNGNFRRKRRRRGETSEAAVPGASSPEGTALEPRGSTPQDPQ 225

  Fly   236 MAASP--------------YGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQAPQ 286
            .:.||              .||.|..:|  |:|...|...:| :|..|.|              .
Mouse   226 TSPSPSEATTTCLSGFSTAMGALAGGFG--ALPDGLAHDFSL-RRPPPTA--------------A 273

  Fly   287 AHHHQAPHPA 296
            ||..|.|:.|
Mouse   274 AHSPQIPNTA 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 55/84 (65%)
Foxi2NP_899016.2 Forkhead 99..184 CDD:333958 56/87 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..237 12/48 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..294 9/36 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.