DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and sep1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_596301.1 Gene:sep1 / 2540866 PomBaseID:SPBC4C3.12 Length:663 Species:Schizosaccharomyces pombe


Alignment Length:234 Identity:76/234 - (32%)
Similarity:108/234 - (46%) Gaps:52/234 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KKPINTATQPIKTEPVHHHHQYVHPYSNSDGELSASEDFDSPSRTSTPMSSAAESLSSQNNDKLD 84
            :||.:.||:|           |:..|:..        .:..|.....|.|..:.......|..:.
pombe    64 QKPSSKATRP-----------YIPSYTRL--------TYSVPPLPIPPPSEQSLDTIIYRNPSVS 109

  Fly    85 VEFDDELED---QLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGI 146
            .....|.|:   .||                    |.|||||||..||.|:|..||::||||:.|
pombe   110 SSQSQEPEEFFLPLD--------------------DGKKPPYSYAMLIGMSIIRSPDRRLTLSAI 154

  Fly   147 YQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGK 211
            |.::.|.|.::..:..||||||||||||||.|.||.|..:.||||::|.:.|..||.|:     |
pombe   155 YDWISNTFSFYNKSNNGWQNSIRHNLSLNKAFMKIERPRNLPGKGHFWSIRPGHEEQFL-----K 214

  Fly   212 LRRKNPGASRTRLAAYRQAIFSPMMAASPYGAPASSYGY 250
            |:.:.||.: :|.|...|.:.|    ::.||:...|.|:
pombe   215 LKLRKPGVN-SRPAPPVQDVTS----STKYGSSTGSSGF 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 46/84 (55%)
sep1NP_596301.1 COG5025 20..663 CDD:227358 76/234 (32%)
Forkhead 128..214 CDD:278670 47/90 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm47190
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.